top of page

Transforming Growth Factor Beta (TGF-β) acts as a potent multifunctional cytokine involved in a diverse range of biological processes including muscle repair, embryogenesis, wound healing, connective tissue development, cell growth and differentiation, cell proliferation and apoptosis, and it contributes to the regulation of immune responses.

Natively, TGF-β is secreted in a latent form complexed with two other polypeptides, the latent TGF-β binding protein and the latency-associated peptide. The cytokine is then activated by the proteolytic cleavage of these two polypeptides, releasing the mature 112 amino acid TGF-β.

Immobazyme's recombinant TGF-β is produced in the methylotrophic yeast, Pichia pastoris and purified using immobilized metal ion affinity chromatography.

Transforming Growth Factor Beta (TGF-β)

$300.00Price
  • Expression

    System

    Pichia pastoris

    Molecular

    Weight

    15.06 kDa (monomer)
    Species Homo sapiens
    Type Protein
    Purity 95% (SDS-PAGE and capillary electrophoresis)

    Endotoxin

    <1 EU/ug protein
    Activity

    TBD

    Form Lyophilized recombinant protein

     

    Amino Acid Sequence

    A0A024R0P8 - A0A024R0P8_HUMAN

    HHHHHHHHHHTSGPGGGGSEFALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

  •  

bottom of page