top of page

IGF-1, also known as Insulin-like Growth Factor 1, is a hormone produced primarily in the liver. It shares a molecular resemblance to insulin and is regulated by Growth Hormone (GH). IGF-1 serves as a crucial mediator in the process of physiological growth, playing a significant role in promoting the growth and development of numerous cell types throughout the body. Its effects are particularly prominent in skeletal muscle, cartilage, bone, liver, kidney, nerve, skin, hematopoietic, and lung cells. By facilitating cellular growth and division, IGF-1 contributes to overall body growth, tissue repair, and maintenance of various organ systems.

Immobazymes recombinant IGF-1 is produced in the methylotrophic yeast, Pichia pastoris and purified using immobilized metal ion affinity chromatography.

Insulin-like Growth Factor 1 (IGF-1)

$75.00Price
  • Expression

    System

    Pichia pastoris

    Molecular

    Weight

    11.39 kDa (monomer)
    Class Recombinant
    Species Homo Sapiens
    Purity <95% (SDS-PAGE and capillary electrophoresis)

    Endotoxin

    <1 EU/ug protein
    Activity

    TBD

    Form

    Lyophilized recombinant protein

     

    Amino Acid Sequence

    HHHHHHHHHHTSGPGGGGSEFGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKS

  •  

bottom of page