top of page

FGF2, also referred to as basic FGF, is a growth factor primarily synthesized in fibroblasts, endothelial cells, and smooth muscle cells. The FGF2 family of myokines consists of 23 signalling proteins that interact with 4 different FGF receptors. These protein-protein signaling interactions contribute to the regulation of cellular proliferation, differentiation, tissue, development, angiogenesis, and wound healing.

Immobazyme's recombinant FGF2 is produced in the methylotrophic yeast, Pichia pastoris, and is purified using immobilized metal ion affinity chromatography.

Fibroblast Growth Factor Basic (FGF-2)

$75.00Price
  • Expression

    System

    Pichia pastoris

    Molecular

    Weight

    16.37 kDa
    Class Recombinant
    Type Protein
    Purity 70%

    Endotoxin

    Concentration

    TBD
    Activity

    TBD

    Form Lyophilized                                                                                

     

    Amino Acid Sequence

    PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

  • IMAC Chromatography

bottom of page