top of page
IGF-1, also known as Insulin-like Growth Factor 1, is a hormone produced primarily in the liver. It shares a molecular resemblance to insulin and is regulated by Growth Hormone (GH). IGF-1 serves as a crucial mediator in the process of physiological growth, playing a significant role in promoting the growth and development of numerous cell types throughout the body.

IGF-1

IGF-1, also known as Insulin-like Growth Factor 1, is a hormone produced primarily in the liver. It shares a molecular resemblance to insulin and is regulated by Growth Hormone (GH). IGF-1 serves as a crucial mediator in the process of physiological growth, playing a significant role in promoting the growth and development of numerous cell types throughout the body. Its effects are particularly prominent in skeletal muscle, cartilage, bone, liver, kidney, nerve, skin, hematopoietic, and lung cells. By facilitating cellular growth and division, IGF-1 contributes to overall body growth, tissue repair, and maintenance of various organ systems.

Immobazymes recombinant IGF-2 is produced in the methylotrophic yeast, Pichia pastoris and purified using immobilized metal ion affinity chromatography.

arrow&v

Name

Insulin-like growth factor I

Size

11.39 kDa (monomer)

Summary

Sequence

HHHHHHHHHHTSGPGGGGSEFGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKS

Purity

>95% (SDS-PAGE and capillary electrophoresis)

Endotoxin

<1 EU/ug protein

Source

Pichia pastoris

Species

Homo sapiens

Animal-origin free

Formulation

Lyophilized recombinant protein

bottom of page